PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003172m
Common NameCARUB_v10003172mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 281aa    MW: 31960 Da    PI: 5.6869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003172mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
  Carubv10003172m 14 KGPWTAEEDKKLINFILNNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.62.2e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  Carubv10003172m  70 LSEAEEQLVIDLHALLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-21563IPR009057Homeodomain-like
PROSITE profilePS5129412.982961IPR017930Myb domain
SuperFamilySSF466895.24E-2613108IPR009057Homeodomain-like
SMARTSM007172.6E-111363IPR001005SANT/Myb domain
PfamPF002498.6E-141461IPR001005SANT/Myb domain
CDDcd001677.99E-81661No hitNo description
PROSITE profilePS5129427.60862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2464116IPR009057Homeodomain-like
SMARTSM007174.2E-1566114IPR001005SANT/Myb domain
PfamPF002491.0E-1470111IPR001005SANT/Myb domain
CDDcd001676.91E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRQPCCDKL MVKKGPWTAE EDKKLINFIL NNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SEAEEQLVID LHALLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKME  120
IDPLTHQPLN KVSSDKKFDD KSETSSKDGN VKRSDDKSLE TDESTKNTIN ETSTITHQNS  180
SKDEYELLGD IIDHKDEDLF NILWTNDEPP LVDVSWSNSI GGAASVVAAD KINMEAGEDL  240
PTWPLEEKNG DNWMFLDYCK DFGVQDFGFC QTSMETGYKD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759990.0AF175999.1 Arabidopsis thaliana putative transcription factor (MYB42) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289620.10.0hypothetical protein CARUB_v10003172mg
SwissprotQ50EX69e-89ODO1_PETHY; Protein ODORANT1
TrEMBLR0HFK30.0R0HFK3_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60025711e-165(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-147myb domain protein 42